AREL1 Antikörper (N-Term)
-
- Target Alle AREL1 Produkte
- AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AREL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIAA0317 antibody was raised against the N terminal of KIAA0317
- Aufreinigung
- Affinity purified
- Immunogen
- KIAA0317 antibody was raised using the N terminal of KIAA0317 corresponding to a region with amino acids LTCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGV
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIAA0317 Blocking Peptide, catalog no. 33R-5469, is also available for use as a blocking control in assays to test for specificity of this KIAA0317 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0317 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))
- Andere Bezeichnung
- KIAA0317 (AREL1 Produkte)
- Synonyme
- KIAA0317 antikoerper, apoptosis resistant E3 ubiquitin protein ligase 1 antikoerper, AREL1 antikoerper
- Hintergrund
- KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.
- Molekulargewicht
- 94 kDa (MW of target protein)
-