MMEL1 Antikörper (Middle Region)

Produktnummer ABIN634822

Produktdetails anti-MMEL1 Antikörper

Target: MMEL1 (Membrane Metallo-Endopeptidase-Like 1 (MMEL1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMEL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MMEL1 antibody was raised against the middle region of MMEL1

Aufreinigung: Affinity purified

Immunogen: MMEL1 antibody was raised using the middle region of MMEL1 corresponding to a region with amino acids EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMEL1 Blocking Peptide, catalog no. 33R-2809, is also available for use as a blocking control in assays to test for specificity of this MMEL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMEL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMEL1

Target: MMEL1 (Membrane Metallo-Endopeptidase-Like 1 (MMEL1))

Andere Bezeichnung: MMEL1 (MMEL1 Produkte)

Synonyme: MMEL2 antikoerper, NEP2 antikoerper, NEPII antikoerper, NL1 antikoerper, NL2 antikoerper, SEP antikoerper, Mell1 antikoerper, Nl1 antikoerper, MMEL1 antikoerper, membrane metalloendopeptidase like 1 antikoerper, membrane metallo-endopeptidase-like 1 antikoerper, MMEL1 antikoerper, Mmel1 antikoerper, mmel1 antikoerper

Hintergrund: MMEL1 is a member of the neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis.

Molekulargewicht: 88 kDa (MW of target protein)