Motilin Antikörper (Middle Region)

Produktnummer ABIN634816

Produktdetails anti-Motilin Antikörper

Target: Motilin (MLN)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Motilin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Motilin antibody was raised against the middle region of MLN

Aufreinigung: Affinity purified

Immunogen: Motilin antibody was raised using the middle region of MLN corresponding to a region with amino acids LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Motilin Blocking Peptide, catalog no. 33R-5335, is also available for use as a blocking control in assays to test for specificity of this Motilin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Motilin

Target: Motilin (MLN)

Andere Bezeichnung: Motilin (MLN Produkte)

Synonyme: MLN antikoerper, motilin antikoerper, MLN antikoerper, Mln antikoerper

Hintergrund: This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility.

Molekulargewicht: 3 kDa (MW of target protein)

Pathways: Hormone Activity