VGF Antikörper (Middle Region)

Produktnummer ABIN634791

Produktdetails anti-VGF Antikörper

Target: VGF (VGF Nerve Growth Factor Inducible (VGF))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VGF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VGF antibody was raised against the middle region of VGF

Aufreinigung: Affinity purified

Immunogen: VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VGF Blocking Peptide, catalog no. 33R-1490, is also available for use as a blocking control in assays to test for specificity of this VGF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VGF

Target: VGF (VGF Nerve Growth Factor Inducible (VGF))

Andere Bezeichnung: VGF (VGF Produkte)

Synonyme: VGF antikoerper, Gm1052 antikoerper, VGF nerve growth factor inducible antikoerper, VGF antikoerper, Vgf antikoerper

Hintergrund: This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis