TFF1 Antikörper (Middle Region)
-
- Target Alle TFF1 Antikörper anzeigen
- TFF1 (Trefoil Factor 1 (TFF1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TFF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TFF1 antibody was raised against the middle region of TFF1
- Aufreinigung
- Affinity purified
- Immunogen
- TFF1 antibody was raised using the middle region of TFF1 corresponding to a region with amino acids PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
- Top Product
- Discover our top product TFF1 Primärantikörper
-
anti-Trefoil Factor 1 (TFF1) antibody
TFF1 Reaktivität: Human IHC, IF, FACS, StM Wirt: Maus Monoclonal TFF1-2133 unconjugated
anti-Trefoil Factor 1 (TFF1) (AA 25-84), (pSer2) antibodyTFF1 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Trefoil Factor 1 (TFF1) antibodyTFF1 Reaktivität: Human, Maus, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Trefoil Factor 1 (TFF1) (AA 1-87) antibodyTFF1 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Trefoil Factor 1 (TFF1) (AA 1-81) antibodyTFF1 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Trefoil Factor 1 (TFF1) (AA 57-84) antibodyTFF1 Reaktivität: Human, Cynomolgus IHC, StM Wirt: Maus Monoclonal GE2-same as R47-94 unconjugated
anti-Trefoil Factor 1 (TFF1) (AA 1-84) antibodyTFF1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3H5 unconjugated
anti-Trefoil Factor 1 (TFF1) (AA 1-84) antibodyTFF1 Reaktivität: Human WB, IHC, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Trefoil Factor 1 (TFF1) (AA 1-88) antibodyTFF1 Reaktivität: Human IHC Wirt: Maus Monoclonal MSVA-482M unconjugated
anti-Trefoil Factor 1 (TFF1) (AA 25-84) antibodyTFF1 Reaktivität: Human IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TFF1 Blocking Peptide, catalog no. 33R-7321, is also available for use as a blocking control in assays to test for specificity of this TFF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TFF1 (Trefoil Factor 1 (TFF1))
- Andere Bezeichnung
- TFF1 (TFF1 Produkte)
- Synonyme
- BCEI antikoerper, D21S21 antikoerper, HP1.A antikoerper, HPS2 antikoerper, pNR-2 antikoerper, pS2 antikoerper, Bcei antikoerper, PS2 antikoerper, bcei antikoerper, d21s21 antikoerper, hp1.a antikoerper, hps2 antikoerper, p1 antikoerper, p1-a antikoerper, pnr-2 antikoerper, ps2 antikoerper, tff1 antikoerper, xP1 antikoerper, xp1-L antikoerper, xp1 antikoerper, TFF1 antikoerper, Ps2 antikoerper, trefoil factor 1 antikoerper, trefoil factor 1 S homeolog antikoerper, trefoil factor 1, gene 2 S homeolog antikoerper, TFF1 antikoerper, Tff1 antikoerper, tff1.S antikoerper, tff1.2.S antikoerper, LOC100358238 antikoerper
- Hintergrund
- Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.
- Molekulargewicht
- 7 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-
