TFF1 Antikörper (Middle Region)

Produktnummer ABIN634784

Der Kaninchen Polyklonal anti-TFF1 Antikörper wird verwendet zum Nachweis von TFF1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TFF1 Antikörper (Middle Region) (ABIN634784)

Target: TFF1 (Trefoil Factor 1 (TFF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TFF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TFF1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TFF1 antibody was raised against the middle region of TFF1

Aufreinigung: Affinity purified

Immunogen: TFF1 antibody was raised using the middle region of TFF1 corresponding to a region with amino acids PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TFF1 Blocking Peptide, (ABIN5616568), is also available for use as a blocking control in assays to test for specificity of this TFF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TFF1

Target: TFF1 (Trefoil Factor 1 (TFF1))

Andere Bezeichnung: TFF1

Hintergrund: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.

Molekulargewicht: 7 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway