FGF13 Antikörper (Middle Region)
-
- Target Alle FGF13 Antikörper anzeigen
- FGF13 (Fibroblast Growth Factor 13 (FGF13))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FGF13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FGF13 antibody was raised against the middle region of FGF13
- Aufreinigung
- Affinity purified
- Immunogen
- FGF13 antibody was raised using the middle region of FGF13 corresponding to a region with amino acids TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK
- Top Product
- Discover our top product FGF13 Primärantikörper
-
anti-Fibroblast Growth Factor 13 (FGF13) antibody
FGF13 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Fibroblast Growth Factor 13 (FGF13) (AA 1-245) antibodyFGF13 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Fibroblast Growth Factor 13 (FGF13) antibodyFGF13 Reaktivität: Human, Ratte, Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibroblast Growth Factor 13 (FGF13) (AA 108-227) antibodyFGF13 Reaktivität: Human WB, IHC, ICC, IP Wirt: Maus Monoclonal unconjugated
anti-Fibroblast Growth Factor 13 (FGF13) (AA 2-18) antibodyFGF13 Reaktivität: Human WB, IHC, ICC, IF Wirt: Maus Monoclonal S235-22 unconjugated
anti-Fibroblast Growth Factor 13 (FGF13) (AA 2-18) antibody (HRP)FGF13 Reaktivität: Human WB, IHC, ICC, IF Wirt: Maus Monoclonal S235-22 HRP
anti-Fibroblast Growth Factor 13 (FGF13) (AA 2-18) antibody (FITC)FGF13 Reaktivität: Human WB, IHC, ICC, IF Wirt: Maus Monoclonal S235-22 FITC
anti-Fibroblast Growth Factor 13 (FGF13) (AA 2-18) antibody (Alkaline Phosphatase (AP))FGF13 Reaktivität: Human WB, IHC, ICC, IF Wirt: Maus Monoclonal S235-22 Alkaline Phosphatase (AP)
anti-Fibroblast Growth Factor 13 (FGF13) (AA 2-18) antibody (Biotin)FGF13 Reaktivität: Human WB, IHC, ICC, IF Wirt: Maus Monoclonal S235-22 Biotin
anti-Fibroblast Growth Factor 13 (FGF13) (AA 2-18) antibody (PE)FGF13 Reaktivität: Human WB, IHC, ICC, IF Wirt: Maus Monoclonal S235-22 PE
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FGF13 Blocking Peptide, catalog no. 33R-9144, is also available for use as a blocking control in assays to test for specificity of this FGF13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FGF13 (Fibroblast Growth Factor 13 (FGF13))
- Andere Bezeichnung
- FGF13 (FGF13 Produkte)
- Synonyme
- FGF13 antikoerper, fgf2 antikoerper, fhf2 antikoerper, fgf13 antikoerper, FGF-13 antikoerper, xFGF13 antikoerper, FGF2 antikoerper, FHF-2 antikoerper, FHF2 antikoerper, Fhf2 antikoerper, zgc:101784 antikoerper, fibroblast growth factor 13 antikoerper, fibroblast growth factor 13 L homeolog antikoerper, fibroblast growth factor 13a antikoerper, FGF13 antikoerper, fgf13 antikoerper, fgf13.L antikoerper, Fgf13 antikoerper, fgf13a antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-
