LYVE1 Antikörper (N-Term)

Produktnummer ABIN634754

Produktdetails anti-LYVE1 Antikörper

Target: LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYVE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LYVE1 antibody was raised against the N terminal of LYVE1

Aufreinigung: Affinity purified

Immunogen: LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYVE1 Blocking Peptide, catalog no. 33R-1461, is also available for use as a blocking control in assays to test for specificity of this LYVE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYVE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-LYVE1 Antikörper (ABIN634754)

Yücel, Johnston, Ly, Patel, Drake, Gümüş, Fraenkl, Moore, Tobbia, Armstrong, Horvath, Gupta: "Identification of lymphatics in the ciliary body of the human eye: a novel "uveolymphatic" outflow pathway." in: Experimental eye research, Vol. 89, Issue 5, pp. 810-9, (2009) (PubMed).

Details zu LYVE1

Target: LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))

Andere Bezeichnung: LYVE1 (LYVE1 Produkte)

Synonyme: LYVE1 antikoerper, XLKD1 antikoerper, CRSBP-1 antikoerper, HAR antikoerper, LYVE-1 antikoerper, 1200012G08Rik antikoerper, Crsbp-1 antikoerper, Lyve-1 antikoerper, Xlkd1 antikoerper, lymphatic vessel endothelial hyaluronic receptor 1a antikoerper, lymphatic vessel endothelial hyaluronan receptor 1 antikoerper, lyve1a antikoerper, LYVE1 antikoerper, Lyve1 antikoerper

Hintergrund: LYVE1 is a type I integral membrane glycoprotein. It acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process