SIGLEC12 Antikörper (N-Term)
-
- Target Alle SIGLEC12 Antikörper anzeigen
- SIGLEC12 (Sialic Acid Binding Ig-Like Lectin 12 (SIGLEC12))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SIGLEC12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SIGLEC12 antibody was raised against the N terminal of SIGLEC12
- Aufreinigung
- Affinity purified
- Immunogen
- SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids LCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHVSRNIPVATNNPARAVQE
- Top Product
- Discover our top product SIGLEC12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SIGLEC12 Blocking Peptide, catalog no. 33R-4835, is also available for use as a blocking control in assays to test for specificity of this SIGLEC12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIGLEC12 (Sialic Acid Binding Ig-Like Lectin 12 (SIGLEC12))
- Andere Bezeichnung
- SIGLEC12 (SIGLEC12 Produkte)
- Synonyme
- S2V antikoerper, SIGLECL1 antikoerper, SLG antikoerper, Siglec-XII antikoerper, sialic acid binding Ig like lectin 12 (gene/pseudogene) antikoerper, sialic acid binding Ig like lectin 12 antikoerper, sialic acid binding Ig-like lectin 12 antikoerper, SIGLEC12 antikoerper
- Hintergrund
- Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member of the SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2.
- Molekulargewicht
- 63 kDa (MW of target protein)
-