Cadherin 8 Antikörper (Middle Region)
-
- Target Alle Cadherin 8 (CDH8) Antikörper anzeigen
- Cadherin 8 (CDH8)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cadherin 8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDH8 antibody was raised against the middle region of CDH8
- Aufreinigung
- Affinity purified
- Immunogen
- CDH8 antibody was raised using the middle region of CDH8 corresponding to a region with amino acids HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL
- Top Product
- Discover our top product CDH8 Primärantikörper
-
anti-Cadherin 8 (CDH8) (Internal Region) antibody
CDH8 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 8 (CDH8) (AA 33-63), (N-Term) antibodyCDH8 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB13681 unconjugated
anti-Cadherin 8 (CDH8) (AA 491-540) antibodyCDH8 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 8 (CDH8) (Middle Region) antibodyCDH8 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Meerschweinchen, Pferd, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 8 (CDH8) (N-Term) antibodyCDH8 Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 8 (CDH8) antibodyCDH8 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 8 (CDH8) (Internal Region) antibodyCDH8 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 8 (CDH8) (AA 653-782) antibodyCDH8 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 8 (CDH8) (Internal Region) antibodyCDH8 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 8 (CDH8) (AA 522-621) antibodyCDH8 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDH8 Blocking Peptide, catalog no. 33R-3721, is also available for use as a blocking control in assays to test for specificity of this CDH8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cadherin 8 (CDH8)
- Andere Bezeichnung
- CDH8 (CDH8 Produkte)
- Synonyme
- AI851472 antikoerper, cad8 antikoerper, cadherin-8 antikoerper, Nbla04261 antikoerper, cadherin 8 antikoerper, cadherin 8, type 2 antikoerper, Cdh8 antikoerper, CDH8 antikoerper
- Hintergrund
- CDH8 is a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain.
- Molekulargewicht
- 81 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-
