PCDHB13 Antikörper (Middle Region)
-
- Target Alle PCDHB13 Antikörper anzeigen
- PCDHB13 (Protocadherin beta 13 (PCDHB13))
-
Bindungsspezifität
- Middle Region
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCDHB13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCDHB13 antibody was raised against the middle region of PCDHB13
- Aufreinigung
- Affinity purified
- Immunogen
- PCDHB13 antibody was raised using the middle region of PCDHB13 corresponding to a region with amino acids GKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVI
- Top Product
- Discover our top product PCDHB13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCDHB13 Blocking Peptide, catalog no. 33R-3378, is also available for use as a blocking control in assays to test for specificity of this PCDHB13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHB13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCDHB13 (Protocadherin beta 13 (PCDHB13))
- Andere Bezeichnung
- PCDHB13 (PCDHB13 Produkte)
- Synonyme
- PCDH-BETA13 antikoerper, Pcdh3 antikoerper, Pcdbh6 antikoerper, PcdhbM antikoerper, PCDHB13 antikoerper, protocadherin beta 13 antikoerper, protocadherin beta 12 antikoerper, protocadherin beta-8 antikoerper, PCDHB13 antikoerper, Pcdhb12 antikoerper, Pcdhb13 antikoerper, LOC518612 antikoerper
- Hintergrund
- PCDHB13 is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily.
- Molekulargewicht
- 85 kDa (MW of target protein)
-