PCDHB13 Antikörper (Middle Region)

Produktnummer ABIN634692

Der Kaninchen Polyklonal anti-PCDHB13 Antikörper (ABIN634692) detektiert spezifisch PCDHB13 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PCDHB13 Antikörper (Middle Region) (ABIN634692)

Target: PCDHB13 (Protocadherin beta 13 (PCDHB13))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHB13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCDHB13 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PCDHB13 antibody was raised against the middle region of PCDHB13

Aufreinigung: Affinity purified

Immunogen: PCDHB13 antibody was raised using the middle region of PCDHB13 corresponding to a region with amino acids GKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHB13 Blocking Peptide, (ABIN938764), is also available for use as a blocking control in assays to test for specificity of this PCDHB13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHB13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHB13

Target: PCDHB13 (Protocadherin beta 13 (PCDHB13))

Andere Bezeichnung: PCDHB13

Hintergrund: PCDHB13 is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily.

Molekulargewicht: 85 kDa (MW of target protein)