DSCAM Antikörper (Middle Region)

Produktnummer ABIN634687

Produktdetails anti-DSCAM Antikörper

Target: DSCAM (Down Syndrome Cell Adhesion Molecule (DSCAM))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DSCAM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DSCAM antibody was raised against the middle region of DSCAM

Aufreinigung: Affinity purified

Immunogen: DSCAM antibody was raised using the middle region of DSCAM corresponding to a region with amino acids MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DSCAM Blocking Peptide, catalog no. 33R-6387, is also available for use as a blocking control in assays to test for specificity of this DSCAM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSCAM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DSCAM

Target: DSCAM (Down Syndrome Cell Adhesion Molecule (DSCAM))

Andere Bezeichnung: DSCAM (DSCAM Produkte)

Synonyme: CHD2-42 antikoerper, CHD2-52 antikoerper, Dscam antikoerper, DSCAM antikoerper, chd2-42 antikoerper, chd2-52 antikoerper, dscam antikoerper, GB15141 antikoerper, 4932410A21Rik antikoerper, 43Bc antikoerper, CG17800 antikoerper, CT39257 antikoerper, DScam antikoerper, DmDscam antikoerper, Dm_2R:13612 antikoerper, Dmel\\CG17800 antikoerper, Dscam-hv antikoerper, Dscam1 antikoerper, FBgn0033159 antikoerper, Neu1 antikoerper, dScam antikoerper, l(2)05518 antikoerper, l(2)43Bc antikoerper, p270 antikoerper, DS cell adhesion molecule antikoerper, Down syndrome cell adhesion molecule antikoerper, Down syndrome cell adhesion molecule a antikoerper, Down syndrome cell adhesion molecule 1 antikoerper, Down syndrome cell adhesion molecule-like protein Dscam2 antikoerper, down syndrome cell adhesion molecule antikoerper, Down syndrome cell adhesion molecule L homeolog antikoerper, DSCAM antikoerper, Dscam antikoerper, dscam antikoerper, dscama antikoerper, Dscam1 antikoerper, LOC5573626 antikoerper, CpipJ_CPIJ006173 antikoerper, dscam.L antikoerper

Hintergrund: DSCAM is a cell adhesion molecule that can mediate cation-independent homophilic binding activity. DSCAM could be involved in nervous system development.

Molekulargewicht: 220 kDa (MW of target protein)

Pathways: Regulation of Cell Size