SSPN Antikörper

Produktnummer ABIN634685

Produktdetails anti-SSPN Antikörper

Target: SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SSPN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Sarcospan antibody was raised using a synthetic peptide corresponding to a region with amino acids AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Sarcospan Blocking Peptide, catalog no. 33R-1245, is also available for use as a blocking control in assays to test for specificity of this Sarcospan antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSPN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SSPN

Target: SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))

Andere Bezeichnung: Sarcospan (SSPN Produkte)

Synonyme: DAGA5 antikoerper, KRAG antikoerper, NSPN antikoerper, SPN1 antikoerper, SPN2 antikoerper, Krag antikoerper, RGD1559723 antikoerper, sarcospan S homeolog antikoerper, sarcospan antikoerper, sspn.S antikoerper, SSPN antikoerper, Sspn antikoerper

Hintergrund: SSPN is a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells.SSPN gene is expressed in a variety of tissues with highest levels in muscle, where alternative splice variants have been observed. In certain tumors KRAS2, SSPN, and ITPR2 are coamplified. The function of this gene is unknown.

Molekulargewicht: 26 kDa (MW of target protein)