GJA4 Antikörper (Middle Region)

Produktnummer ABIN634684

Produktdetails anti-GJA4 Antikörper

Target: GJA4 (Gap Junction Protein, alpha 4, 37kDa (GJA4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJA4 antibody was raised against the middle region of GJA4

Aufreinigung: Affinity purified

Immunogen: GJA4 antibody was raised using the middle region of GJA4 corresponding to a region with amino acids QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJA4 Blocking Peptide, catalog no. 33R-7598, is also available for use as a blocking control in assays to test for specificity of this GJA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJA4

Target: GJA4 (Gap Junction Protein, alpha 4, 37kDa (GJA4))

Andere Bezeichnung: GJA4 (GJA4 Produkte)

Synonyme: AU020209 antikoerper, AW558810 antikoerper, Cnx37 antikoerper, Cx37 antikoerper, Gja-4 antikoerper, CXN37 antikoerper, CX37 antikoerper, Cx39 antikoerper, ggCx39 antikoerper, cx41 antikoerper, gja4 antikoerper, gap junction protein alpha 4 antikoerper, gap junction protein, alpha 4 antikoerper, gap junction protein, alpha 4, 37kDa antikoerper, gap junction protein alpha 4 L homeolog antikoerper, GJA4 antikoerper, Gja4 antikoerper, gja4.L antikoerper

Hintergrund: GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization