Cx40/GJA5 Antikörper (N-Term)

Produktnummer ABIN634682

Produktdetails anti-Cx40/GJA5 Antikörper

Target: Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cx40/GJA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJA5 antibody was raised against the N terminal of GJA5

Aufreinigung: Affinity purified

Immunogen: GJA5 antibody was raised using the N terminal of GJA5 corresponding to a region with amino acids STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJA5 Blocking Peptide, catalog no. 33R-8882, is also available for use as a blocking control in assays to test for specificity of this GJA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cx40/GJA5

Target: Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))

Andere Bezeichnung: GJA5 (GJA5 Produkte)

Synonyme: Cx40 antikoerper, 5730555N10Rik antikoerper, Cnx40 antikoerper, Gja-5 antikoerper, ATFB11 antikoerper, CX40 antikoerper, gap junction protein, alpha 5 antikoerper, gap junction protein alpha 5 antikoerper, Gja5 antikoerper, GJA5 antikoerper

Hintergrund: GJA5 belongs to the connexin family, alpha-type subfamily. It is an integral membrane protein that forms transmembrane channels, and may function in small molecule transport, muscle contraction and cell-cell communication. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization