GJA9 Antikörper (Middle Region)
-
- Target Alle GJA9 Antikörper anzeigen
- GJA9 (Gap Junction Protein, alpha 9, 59kDa (GJA9))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GJA9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GJA9 antibody was raised against the middle region of GJA9
- Aufreinigung
- Affinity purified
- Immunogen
- GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK
- Top Product
- Discover our top product GJA9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GJA9 Blocking Peptide, catalog no. 33R-3913, is also available for use as a blocking control in assays to test for specificity of this GJA9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJA9 (Gap Junction Protein, alpha 9, 59kDa (GJA9))
- Andere Bezeichnung
- GJA9 (GJA9 Produkte)
- Synonyme
- CX58 antikoerper, CX59 antikoerper, GJA10 antikoerper, gap junction protein alpha 9 antikoerper, GJA9 antikoerper
- Hintergrund
- Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits.
- Molekulargewicht
- 59 kDa (MW of target protein)
-