GJA9 Antikörper (Middle Region)

Produktnummer ABIN634673

Produktdetails anti-GJA9 Antikörper

Target: GJA9 (Gap Junction Protein, alpha 9, 59kDa (GJA9))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJA9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJA9 antibody was raised against the middle region of GJA9

Aufreinigung: Affinity purified

Immunogen: GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJA9 Blocking Peptide, catalog no. 33R-3913, is also available for use as a blocking control in assays to test for specificity of this GJA9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJA9

Target: GJA9 (Gap Junction Protein, alpha 9, 59kDa (GJA9))

Andere Bezeichnung: GJA9 (GJA9 Produkte)

Synonyme: CX58 antikoerper, CX59 antikoerper, GJA10 antikoerper, gap junction protein alpha 9 antikoerper, GJA9 antikoerper

Hintergrund: Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits.

Molekulargewicht: 59 kDa (MW of target protein)