C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) Antikörper
-
- Target Alle C-Type Lectin Domain Family 4, Member M (CLEC4M) Antikörper anzeigen
- C-Type Lectin Domain Family 4, Member M (CLEC4M)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CLEC4 M antibody was raised against the n terminal of CLEC4
- Aufreinigung
- Affinity purified
- Immunogen
- CLEC4 M antibody was raised using the N terminal of CLEC4 corresponding to a region with amino acids MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA
- Top Product
- Discover our top product CLEC4M Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CLEC4M Blocking Peptide, catalog no. 33R-6413, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C-Type Lectin Domain Family 4, Member M (CLEC4M)
- Andere Bezeichnung
- CLEC4M (CLEC4M Produkte)
- Synonyme
- CD209L antikoerper, CD299 antikoerper, DC-SIGN2 antikoerper, DC-SIGNR antikoerper, DCSIGNR antikoerper, HP10347 antikoerper, L-SIGN antikoerper, LSIGN antikoerper, CD209B antikoerper, C-type lectin domain family 4 member M antikoerper, CLEC4M antikoerper
- Hintergrund
- CLEC4M is a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. It is involved in the innate immune system and recognises numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health.
- Molekulargewicht
- 30 kDa (MW of target protein)
-