LGALS3BP Antikörper (Middle Region)

Produktnummer ABIN634658

Produktdetails anti-LGALS3BP Antikörper

Target: LGALS3BP (Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LGALS3BP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LGALS3 BP antibody was raised against the middle region of LGALS3 P

Aufreinigung: Affinity purified

Immunogen: LGALS3 BP antibody was raised using the middle region of LGALS3 P corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LGALS3BP Blocking Peptide, catalog no. 33R-6776, is also available for use as a blocking control in assays to test for specificity of this LGALS3BP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-LGALS3BP Antikörper (ABIN634658)

Langley, Willeit, Didangelos, Matic, Skroblin, Barallobre-Barreiro, Lengquist, Rungger, Kapustin, Kedenko, Molenaar, Lu, Barwari, Suna, Yin, Iglseder, Paulweber, Willeit, Shalhoub, Pasterkamp, Davies et al.: "Extracellular matrix proteomics identifies molecular signature of symptomatic carotid plaques. ..." in: The Journal of clinical investigation, Vol. 127, Issue 4, pp. 1546-1560, (2017) (PubMed).

Details zu LGALS3BP

Target: LGALS3BP (Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP))

Andere Bezeichnung: LGALS3BP (LGALS3BP Produkte)

Synonyme: 90K antikoerper, BTBD17B antikoerper, MAC-2-BP antikoerper, TANGO10B antikoerper, Ppicap antikoerper, CyCAP antikoerper, MAC-2BP antikoerper, Tango10b antikoerper, lgals3bp antikoerper, zgc:136780 antikoerper, MAC2BP antikoerper, Mac-2 BP antikoerper, zgc:77059 antikoerper, galectin 3 binding protein antikoerper, lectin, galactoside-binding, soluble, 3 binding protein antikoerper, calcium activated nucleotidase 1 antikoerper, lectin, galactoside-binding, soluble, 3 binding protein a antikoerper, lectin, galactoside-binding, soluble, 3 binding protein b antikoerper, LGALS3BP antikoerper, Lgals3bp antikoerper, CANT1 antikoerper, lgals3bpa antikoerper, lgals3bpb antikoerper

Hintergrund: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

Molekulargewicht: 63 kDa (MW of target protein)