PROS1 Antikörper

Produktnummer ABIN634646

Produktdetails anti-PROS1 Antikörper

Target: PROS1 (PROS) (Protein S (PROS))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PROS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Protein S antibody was raised using a synthetic peptide corresponding to a region with amino acids MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Protein S Blocking Peptide, catalog no. 33R-5808, is also available for use as a blocking control in assays to test for specificity of this Protein S antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PROS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PROS1

Target: PROS1 (PROS) (Protein S (PROS))

Andere Bezeichnung: Protein S (PROS Produkte)

Synonyme: PROS antikoerper, PS21 antikoerper, PS22 antikoerper, PS23 antikoerper, PS24 antikoerper, PS25 antikoerper, PSA antikoerper, THPH5 antikoerper, THPH6 antikoerper, zgc:154001 antikoerper, AW214361 antikoerper, protein S antikoerper, protein S (alpha) antikoerper, PROS1 antikoerper, Pros1 antikoerper, pros1 antikoerper

Hintergrund: PROS1 is an anticoagulant plasma protein, it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

Molekulargewicht: 71 kDa (MW of target protein)