Laminin gamma 1 Antikörper
-
- Target Alle Laminin gamma 1 (LAMC1) Antikörper anzeigen
- Laminin gamma 1 (LAMC1) (Laminin, gamma 1 (LAMC1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Laminin gamma 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Laminin Gamma 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ
- Top Product
- Discover our top product LAMC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Laminin Gamma 1 Blocking Peptide, catalog no. 33R-3677, is also available for use as a blocking control in assays to test for specificity of this Laminin Gamma 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Laminin gamma 1 (LAMC1) (Laminin, gamma 1 (LAMC1))
- Andere Bezeichnung
- Laminin gamma 1 (LAMC1 Produkte)
- Synonyme
- lamb2 antikoerper, Lamb2 antikoerper, B2e antikoerper, sly antikoerper, LAMB2 antikoerper, putative laminin gamma-1 chain antikoerper, laminin subunit gamma 1 antikoerper, laminin, gamma 1 antikoerper, Smp_163810 antikoerper, lamc1 antikoerper, Lamc1 antikoerper, LAMC1 antikoerper
- Hintergrund
- Laminin is a complex glycoprotein, consisting of three different polypeptide chains (alpha, beta, gamma), which are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
- Molekulargewicht
- 177 kDa (MW of target protein)
-