MYBPC2 Antikörper (N-Term)

Produktnummer ABIN634628

Produktdetails anti-MYBPC2 Antikörper

Target: MYBPC2 (Myosin Binding Protein C, Fast Type (MYBPC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYBPC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MYBPC2 antibody was raised against the N terminal of MYBPC2

Aufreinigung: Affinity purified

Immunogen: MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MYBPC2 Blocking Peptide, catalog no. 33R-4316, is also available for use as a blocking control in assays to test for specificity of this MYBPC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYBPC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MYBPC2

Target: MYBPC2 (Myosin Binding Protein C, Fast Type (MYBPC2))

Andere Bezeichnung: MYBPC2 (MYBPC2 Produkte)

Synonyme: MYBPC antikoerper, MYBPCF antikoerper, im:7137115 antikoerper, im:7150089 antikoerper, zgc:110761 antikoerper, myosin binding protein C, fast-type antikoerper, myosin binding protein C, fast type antikoerper, myosin-binding protein C, fast-type antikoerper, myosin binding protein C, fast type b antikoerper, Mybpc2 antikoerper, MYBPC2 antikoerper, LOC520988 antikoerper, mybpc2b antikoerper

Hintergrund: MYBPC2 encodes a member of the myosin-binding protein family C family. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. Mutations in this gene have been associated with hypertrophic cardiomyopathy.

Molekulargewicht: 128 kDa (MW of target protein)