COL6A1 Antikörper (Middle Region)

Produktnummer ABIN634616

Produktdetails anti-COL6A1 Antikörper

Target: COL6A1 (Collagen, Type VI, alpha 1 (COL6A1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COL6A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Collagen Type VI Alpha 1 antibody was raised against the middle region of COL6 A1

Aufreinigung: Affinity purified

Immunogen: Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6 A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Collagen Type VI Alpha 1 Blocking Peptide, catalog no. 33R-1097, is also available for use as a blocking control in assays to test for specificity of this Collagen Type VI Alpha 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COL0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COL6A1

Target: COL6A1 (Collagen, Type VI, alpha 1 (COL6A1))

Andere Bezeichnung: Collagen Type VI alpha 1 (COL6A1 Produkte)

Synonyme: CBR antikoerper, SDR21C1 antikoerper, hCBR1 antikoerper, OPLL antikoerper, AI747156 antikoerper, Col6a-1 antikoerper, RGD1565398 antikoerper, COL6A1 antikoerper, carbonyl reductase 1 antikoerper, collagen type VI alpha 1 chain antikoerper, collagen, type VI, alpha 1 antikoerper, collagen, type VI, alpha 1 L homeolog antikoerper, collagen type VI alpha 3 chain antikoerper, collagen alpha-1(VI) chain antikoerper, CBR1 antikoerper, COL6A1 antikoerper, Col6a1 antikoerper, col6a1.L antikoerper, COL6A3 antikoerper, col6a1 antikoerper, LOC100623720 antikoerper

Hintergrund: The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils.

Molekulargewicht: 106 kDa (MW of target protein)

Pathways: Growth Factor Binding, SARS-CoV-2 Protein Interaktom