Annexin IV Antikörper (Middle Region)
-
- Target Alle Annexin IV (ANXA4) Antikörper anzeigen
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Chemical
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin IV Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Annexin A4 antibody was raised against the middle region of ANXA4
- Kreuzreaktivität
- Human
- Aufreinigung
- Affinity purified
- Immunogen
- Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL
- Top Product
- Discover our top product ANXA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Annexin A4 Blocking Peptide, catalog no. 33R-2421, is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
- Andere Bezeichnung
- Annexin A4 (ANXA4 Produkte)
- Synonyme
- ANXA4 antikoerper, Anx4 antikoerper, XAnx4 antikoerper, pig28 antikoerper, X-anx4 antikoerper, Xanx-4 antikoerper, ANXIV antikoerper, anx4 antikoerper, ANX4 antikoerper, PIG28 antikoerper, ZAP36 antikoerper, Annexin-4 antikoerper, P32.5 antikoerper, PAP-II antikoerper, PP4-X antikoerper, AI265406 antikoerper, AIV antikoerper, AW106930 antikoerper, annexin A4 antikoerper, annexin A4 L homeolog antikoerper, ANXA4 antikoerper, anxa4 antikoerper, CC1G_00713 antikoerper, LOC100280951 antikoerper, Anxa4 antikoerper, anxa4.L antikoerper
- Substanzklasse
- Chemical
- Hintergrund
- Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 gene has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity.
- Molekulargewicht
- 36 kDa (MW of target protein)
-