PEA15 Antikörper (Middle Region)

Produktnummer ABIN634601

Produktdetails anti-PEA15 Antikörper

Target: PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEA15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PEA15 antibody was raised against the middle region of PEA15

Aufreinigung: Affinity purified

Immunogen: PEA15 antibody was raised using the middle region of PEA15 corresponding to a region with amino acids DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEA15 Blocking Peptide, catalog no. 33R-2058, is also available for use as a blocking control in assays to test for specificity of this PEA15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEA15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEA15

Target: PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))

Andere Bezeichnung: PEA15 (PEA15 Produkte)

Synonyme: HMAT1 antikoerper, HUMMAT1H antikoerper, MAT1 antikoerper, MAT1H antikoerper, PEA-15 antikoerper, PED antikoerper, Pea15a antikoerper, PEA15 antikoerper, DKFZp459O1410 antikoerper, proliferation and apoptosis adaptor protein 15 antikoerper, phosphoprotein enriched in astrocytes 15 antikoerper, proliferation and apoptosis adaptor protein 15 L homeolog antikoerper, Astrocytic phosphoprotein PEA-15 antikoerper, PEA15 antikoerper, Pea15 antikoerper, pea15.L antikoerper, pea15 antikoerper

Hintergrund: PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.

Molekulargewicht: 15 kDa (MW of target protein)