Programmed Cell Death 7 (PDCD7) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN634585, Anbieter: Anmelden zum Anzeigen
  • C80112
  • ES18
  • HES18
  • programmed cell death 7
  • Pdcd7
  • PDCD7
Middle Region
Human, Maus, Ratte (Rattus)
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT
Spezifität PDCD7 antibody was raised against the middle region of PDCD7
Reinigung Affinity purified
Andere Bezeichnung PDCD7 (PDCD7 Antibody Abstract)
Hintergrund PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells.
Molekulargewicht 55 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

PDCD7 Blocking Peptide, catalog no. 33R-10177, is also available for use as a blocking control in assays to test for specificity of this PDCD7 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD7 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Western Blotting (WB) image for anti-Programmed Cell Death 7 (PDCD7) (Middle Region) antibody (ABIN634585) PDCD7 antibody used at 1 ug/ml to detect target protein.
Haben Sie etwas anderes gesucht?