BCAP31 Antikörper (Middle Region)

Produktnummer ABIN634582

Produktdetails anti-BCAP31 Antikörper

Target: BCAP31 (B-Cell Receptor-Associated Protein 31 (BCAP31))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BCAP31 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BCAP31 antibody was raised against the middle region of BCAP31

Aufreinigung: Affinity purified

Immunogen: BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BCAP31 Blocking Peptide, catalog no. 33R-8871, is also available for use as a blocking control in assays to test for specificity of this BCAP31 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAP31 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BCAP31

Target: BCAP31 (B-Cell Receptor-Associated Protein 31 (BCAP31))

Andere Bezeichnung: BCAP31 (BCAP31 Produkte)

Synonyme: 6c6-ag antikoerper, bap31 antikoerper, cdm antikoerper, dxs1357e antikoerper, BCAP31 antikoerper, Bap31 antikoerper, 6C6-AG antikoerper, BAP31 antikoerper, CDM antikoerper, DXS1357E antikoerper, CALD1 antikoerper, caldesmon antikoerper, si:bz30i22.4 antikoerper, si:rp71-30i22.4 antikoerper, zgc:56389 antikoerper, B-cell receptor associated protein 31 antikoerper, receptor-associated protein antikoerper, lipopeptide mating pheromone precursor bap3-1 antikoerper, B cell receptor associated protein 31 antikoerper, B-cell receptor-associated protein 31 antikoerper, B-cell receptor associated protein 31 L homeolog antikoerper, bcap31 antikoerper, BAP31 antikoerper, bap3-1 antikoerper, BCAP31 antikoerper, Bcap31 antikoerper, bcap31.L antikoerper

Hintergrund: BCAP31 is a member of the B-cell receptor associated protein 31 superfamily. It is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity