CXCL16 Antikörper

Produktnummer ABIN634580

Der Kaninchen Polyklonal anti-CXCL16 Antikörper wird verwendet zum Nachweis von CXCL16 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CXCL16 Antikörper (ABIN634580)

Target: CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CXCL16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CXCL16 Antikörper

Aufreinigung: Affinity purified

Immunogen: CXCL16 antibody was raised using a synthetic peptide corresponding to a region with amino acids TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CXCL16 Blocking Peptide, (ABIN5613044), is also available for use as a blocking control in assays to test for specificity of this CXCL16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXCL16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CXCL16

Target: CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))

Andere Bezeichnung: CXCL16

Hintergrund: CXCL16 acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. It induces a strong chemotactic response and calcium mobilization.

Molekulargewicht: 29 kDa (MW of target protein)