CXCL16 Antikörper

Produktnummer ABIN634580

Produktdetails anti-CXCL16 Antikörper

Target: CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CXCL16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CXCL16 antibody was raised using a synthetic peptide corresponding to a region with amino acids TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CXCL16 Blocking Peptide, catalog no. 33R-8984, is also available for use as a blocking control in assays to test for specificity of this CXCL16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXCL16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CXCL16

Target: CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))

Andere Bezeichnung: CXCL16 (CXCL16 Produkte)

Synonyme: CXCL16 antikoerper, 0910001K24Rik antikoerper, AV290116 antikoerper, BB024863 antikoerper, CXCL16v1 antikoerper, CXCL16v2 antikoerper, SR-PSOX antikoerper, Zmynd15 antikoerper, b2b498Clo antikoerper, CXCLG16 antikoerper, SRPSOX antikoerper, C-X-C motif chemokine ligand 16 antikoerper, chemokine (C-X-C motif) ligand 16 antikoerper, CXCL16 antikoerper, Cxcl16 antikoerper

Hintergrund: CXCL16 acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. It induces a strong chemotactic response and calcium mobilization.

Molekulargewicht: 29 kDa (MW of target protein)