CCR2 Antikörper

Produktnummer ABIN634540

Produktdetails anti-CCR2 Antikörper

Target: CCR2 (Chemokine (C-C Motif) Receptor 2 (CCR2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CCR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCR2 Blocking Peptide, catalog no. 33R-5054, is also available for use as a blocking control in assays to test for specificity of this CCR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCR2

Target: CCR2 (Chemokine (C-C Motif) Receptor 2 (CCR2))

Andere Bezeichnung: CCR2 (CCR2 Produkte)

Synonyme: CC-CKR-2 antikoerper, CCR-2 antikoerper, CCR2A antikoerper, CCR2B antikoerper, CD192 antikoerper, CKR2 antikoerper, CKR2A antikoerper, CKR2B antikoerper, CMKBR2 antikoerper, MCP-1-R antikoerper, ACKR5 antikoerper, CKRX antikoerper, CRAM antikoerper, CRAM-A antikoerper, CRAM-B antikoerper, HCR antikoerper, Cc-ckr-2 antikoerper, Ccr2a antikoerper, Ccr2b antikoerper, Ckr2 antikoerper, Ckr2a antikoerper, Ckr2b antikoerper, Cmkbr2 antikoerper, mJe-r antikoerper, C-C motif chemokine receptor 2 antikoerper, C-C motif chemokine receptor like 2 antikoerper, chemokine (C-C motif) receptor 2 antikoerper, CCR2 antikoerper, CCRL2 antikoerper, Ccr2 antikoerper, LOC484790 antikoerper

Hintergrund: This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: cAMP Metabolic Process, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process