TAP1 Antikörper

Produktnummer ABIN634533

Produktdetails anti-TAP1 Antikörper

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TAP1 Blocking Peptide, catalog no. 33R-5544, is also available for use as a blocking control in assays to test for specificity of this TAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TAP1

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Andere Bezeichnung: TAP1 (TAP1 Produkte)

Synonyme: ABC17 antikoerper, ABCB2 antikoerper, APT1 antikoerper, D6S114E antikoerper, PSF-1 antikoerper, PSF1 antikoerper, RING4 antikoerper, TAP1*0102N antikoerper, TAP1N antikoerper, abc17 antikoerper, abcb2 antikoerper, apt1 antikoerper, psf1 antikoerper, ring4 antikoerper, tap1a antikoerper, tap1n antikoerper, Abcb2 antikoerper, Ham-1 antikoerper, Ham1 antikoerper, MTP1 antikoerper, TAP antikoerper, Tap-1 antikoerper, Y3 antikoerper, Cim antikoerper, transporter 1, ATP binding cassette subfamily B member antikoerper, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) L homeolog antikoerper, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) antikoerper, TAP1 antikoerper, tap1.L antikoerper, Tap1 antikoerper

Hintergrund: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).

Molekulargewicht: 87 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process