TAP1 Antikörper
-
- Target Alle TAP1 Antikörper anzeigen
- TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TAP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL
- Top Product
- Discover our top product TAP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TAP1 Blocking Peptide, catalog no. 33R-5544, is also available for use as a blocking control in assays to test for specificity of this TAP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))
- Andere Bezeichnung
- TAP1 (TAP1 Produkte)
- Synonyme
- ABC17 antikoerper, ABCB2 antikoerper, APT1 antikoerper, D6S114E antikoerper, PSF-1 antikoerper, PSF1 antikoerper, RING4 antikoerper, TAP1*0102N antikoerper, TAP1N antikoerper, abc17 antikoerper, abcb2 antikoerper, apt1 antikoerper, psf1 antikoerper, ring4 antikoerper, tap1a antikoerper, tap1n antikoerper, Abcb2 antikoerper, Ham-1 antikoerper, Ham1 antikoerper, MTP1 antikoerper, TAP antikoerper, Tap-1 antikoerper, Y3 antikoerper, Cim antikoerper, transporter 1, ATP binding cassette subfamily B member antikoerper, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) L homeolog antikoerper, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) antikoerper, TAP1 antikoerper, tap1.L antikoerper, Tap1 antikoerper
- Hintergrund
- The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).
- Molekulargewicht
- 87 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Human Leukocyte Antigen (HLA) in Adaptive Immune Response
-