CCRL2 Antikörper
-
- Target Alle CCRL2 Antikörper anzeigen
- CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCRL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CCRL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL
- Top Product
- Discover our top product CCRL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCRL2 Blocking Peptide, catalog no. 33R-5410, is also available for use as a blocking control in assays to test for specificity of this CCRL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCRL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))
- Andere Bezeichnung
- CCRL2 (CCRL2 Produkte)
- Synonyme
- CCRL2 antikoerper, ACKR5 antikoerper, CKRX antikoerper, CRAM antikoerper, CRAM-A antikoerper, CRAM-B antikoerper, HCR antikoerper, 1810047I05Rik antikoerper, Ackr5 antikoerper, CCR11 antikoerper, Cmkbr1l2 antikoerper, E01 antikoerper, L-CCR antikoerper, C-C motif chemokine receptor like 2 antikoerper, chemokine (C-C motif) receptor-like 2 antikoerper, Ccrl2 antikoerper, CCRL2 antikoerper
- Hintergrund
- CCRL2 is a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. CCRL2 gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown.
- Molekulargewicht
- 39 kDa (MW of target protein)
-