CCRL2 Antikörper

Produktnummer ABIN634522

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CCRL2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für CCRL2 Antikörper (ABIN634522)

Target: CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCRL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCRL2 Antikörper

Aufreinigung: Affinity purified

Immunogen: CCRL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCRL2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CCRL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCRL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCRL2

Target: CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))

Andere Bezeichnung: CCRL2

Hintergrund: CCRL2 is a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. CCRL2 gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown.

Molekulargewicht: 39 kDa (MW of target protein)