CHST15 Antikörper (Middle Region)

Produktnummer ABIN634517

Produktdetails anti-CHST15 Antikörper

Target: CHST15 (Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHST15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GALNAC4 S-4 T antibody was raised against the middle region of GALNAC4 -4 T

Aufreinigung: Affinity purified

Immunogen: GALNAC4 S-4 T antibody was raised using the middle region of GALNAC4 -4 T corresponding to a region with amino acids YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALNAC4S-6ST Blocking Peptide, catalog no. 33R-10074, is also available for use as a blocking control in assays to test for specificity of this GALNAC4S-6ST antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNAC0 -0 T antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHST15

Target: CHST15 (Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15))

Andere Bezeichnung: GALNAC4S-6ST (CHST15 Produkte)

Synonyme: GALNAC4S-6ST antikoerper, BRAG antikoerper, RP11-47G11.1 antikoerper, 4631426J05Rik antikoerper, GalNAcS-6ST antikoerper, MAd5 antikoerper, mKIAA0598 antikoerper, GalNAc4S6ST antikoerper, Galnac4s-6st antikoerper, carbohydrate sulfotransferase 15 antikoerper, carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15 antikoerper, CHST15 antikoerper, chst15 antikoerper, Chst15 antikoerper

Hintergrund: GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression, however such results are unclear in vivo.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process