NPY1R Antikörper (Middle Region)

Produktnummer ABIN634513

Produktdetails anti-NPY1R Antikörper

Target: NPY1R (Neuropeptide Y Receptor Y1 (NPY1R))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NPY1R Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NPY1 R antibody was raised against the middle region of NPY1

Aufreinigung: Affinity purified

Immunogen: NPY1 R antibody was raised using the middle region of NPY1 corresponding to a region with amino acids TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NPY1R Blocking Peptide, catalog no. 33R-9008, is also available for use as a blocking control in assays to test for specificity of this NPY1R antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPY0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NPY1R

Target: NPY1R (Neuropeptide Y Receptor Y1 (NPY1R))

Andere Bezeichnung: NPY1R (NPY1R Produkte)

Synonyme: NPY1-R antikoerper, NPYR antikoerper, NPY-1 antikoerper, NPY1R antikoerper, si:dkey-253i9.3 antikoerper, Npyr antikoerper, Y1-R antikoerper, npy1r-A antikoerper, npyr antikoerper, neuropeptide Y receptor Y1 antikoerper, neuropeptide Y receptor Y1 S homeolog antikoerper, NPY1R antikoerper, Npy1r antikoerper, npy1r antikoerper, npy1r.S antikoerper

Hintergrund: Neuropeptide Y (NPY) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Feeding Behaviour