SAA4 Antikörper (Middle Region)
-
- Target Alle SAA4 Antikörper anzeigen
- SAA4 (Serum Amyloid A 4 (SAA4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SAA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SAA4 antibody was raised against the middle region of SAA4
- Aufreinigung
- Affinity purified
- Immunogen
- SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF
- Top Product
- Discover our top product SAA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SAA4 Blocking Peptide, catalog no. 33R-1030, is also available for use as a blocking control in assays to test for specificity of this SAA4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SAA4 (Serum Amyloid A 4 (SAA4))
- Andere Bezeichnung
- SAA4 (SAA4 Produkte)
- Synonyme
- C-SAA antikoerper, CSAA antikoerper, serum amyloid A4, constitutive antikoerper, SAA4 antikoerper
- Hintergrund
- SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.
- Molekulargewicht
- 2 kDa (MW of target protein)
-