PF4V1 Antikörper (Middle Region)

Produktnummer ABIN634485

Der Kaninchen Polyklonal anti-PF4V1 Antikörper (ABIN634485) detektiert spezifisch PF4V1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PF4V1 Antikörper (Middle Region) (ABIN634485)

Target: PF4V1 (Platelet Factor 4 Variant 1 (PF4V1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PF4V1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PF4V1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PF4 V1 antibody was raised against the middle region of PF4 1

Aufreinigung: Affinity purified

Immunogen: PF4 V1 antibody was raised using the middle region of PF4 1 corresponding to a region with amino acids RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PF4V1 Blocking Peptide, (ABIN5615321), is also available for use as a blocking control in assays to test for specificity of this PF4V1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PF4V1

Target: PF4V1 (Platelet Factor 4 Variant 1 (PF4V1))

Andere Bezeichnung: PF4V1

Hintergrund: PF4V1 is the inhibitor of angiogenesis. PF4V1 is the inhibitor of endothelial cell chemotaxis (in vitro).

Molekulargewicht: 11 kDa (MW of target protein)