PF4V1 Antikörper (Middle Region)

Produktnummer ABIN634485

Produktdetails anti-PF4V1 Antikörper

Target: PF4V1 (Platelet Factor 4 Variant 1 (PF4V1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PF4V1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PF4 V1 antibody was raised against the middle region of PF4 1

Aufreinigung: Affinity purified

Immunogen: PF4 V1 antibody was raised using the middle region of PF4 1 corresponding to a region with amino acids RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PF4V1 Blocking Peptide, catalog no. 33R-8103, is also available for use as a blocking control in assays to test for specificity of this PF4V1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PF4V1

Target: PF4V1 (Platelet Factor 4 Variant 1 (PF4V1))

Andere Bezeichnung: PF4V1 (PF4V1 Produkte)

Synonyme: PF4A antikoerper, CXCL4L1 antikoerper, CXCL4V1 antikoerper, PF4-ALT antikoerper, SCYB4V1 antikoerper, PF4V1 antikoerper, platelet factor 4 variant 1 antikoerper, PF4V1 antikoerper

Hintergrund: PF4V1 is the inhibitor of angiogenesis. PF4V1 is the inhibitor of endothelial cell chemotaxis (in vitro).

Molekulargewicht: 11 kDa (MW of target protein)