SFTPD Antikörper (Middle Region)

Produktnummer ABIN634484

Der Kaninchen Polyklonal anti-SFTPD Antikörper wird verwendet zum Nachweis von SFTPD in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SFTPD Antikörper (Middle Region) (ABIN634484)

Target: SFTPD (Surfactant Protein D (SFTPD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFTPD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SFTPD Antikörper

Bindungsspezifität: Middle Region

Spezifität: SFTPD antibody was raised against the middle region of SFTPD

Aufreinigung: Affinity purified

Immunogen: SFTPD antibody was raised using the middle region of SFTPD corresponding to a region with amino acids PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFTPD Blocking Peptide, (ABIN5616110), is also available for use as a blocking control in assays to test for specificity of this SFTPD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFTPD

Target: SFTPD (Surfactant Protein D (SFTPD))

Andere Bezeichnung: SFTPD

Hintergrund: SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant.

Molekulargewicht: 35 kDa (MW of target protein)