SFTPD Antikörper (Middle Region)
-
- Target Alle SFTPD Antikörper anzeigen
- SFTPD (Surfactant Protein D (SFTPD))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SFTPD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SFTPD antibody was raised against the middle region of SFTPD
- Aufreinigung
- Affinity purified
- Immunogen
- SFTPD antibody was raised using the middle region of SFTPD corresponding to a region with amino acids PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA
- Top Product
- Discover our top product SFTPD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFTPD Blocking Peptide, catalog no. 33R-7253, is also available for use as a blocking control in assays to test for specificity of this SFTPD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFTPD (Surfactant Protein D (SFTPD))
- Andere Bezeichnung
- SFTPD (SFTPD Produkte)
- Synonyme
- COLEC7 antikoerper, PSP-D antikoerper, SFTP4 antikoerper, SP-D antikoerper, BDE antikoerper, BDSD antikoerper, HOX4I antikoerper, SPD antikoerper, AI573415 antikoerper, Sftp4 antikoerper, surfactant protein D antikoerper, homeobox D13 antikoerper, surfactant associated protein D antikoerper, SFTPD antikoerper, HOXD13 antikoerper, Sftpd antikoerper, SP-D antikoerper
- Hintergrund
- SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant.
- Molekulargewicht
- 35 kDa (MW of target protein)
-