OAS2 Antikörper (N-Term)
-
- Target Alle OAS2 Antikörper anzeigen
- OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OAS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OAS2 antibody was raised against the N terminal of OAS2
- Aufreinigung
- Affinity purified
- Immunogen
- OAS2 antibody was raised using the N terminal of OAS2 corresponding to a region with amino acids DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL
- Top Product
- Discover our top product OAS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OAS2 Blocking Peptide, catalog no. 33R-1912, is also available for use as a blocking control in assays to test for specificity of this OAS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))
- Andere Bezeichnung
- OAS2 (OAS2 Produkte)
- Synonyme
- Oasl11 antikoerper, 2'-5'-oligoadenylate synthetase 2 antikoerper, 2'-5' oligoadenylate synthetase 2 antikoerper, 2'-5'-oligoadenylate synthetase 2, 69/71kDa antikoerper, OAS2 antikoerper, Oas2 antikoerper
- Hintergrund
- OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.
- Molekulargewicht
- 79 kDa (MW of target protein)
- Pathways
- Hepatitis C
-