RCAN3 Antikörper (Middle Region)
-
- Target Alle RCAN3 Antikörper anzeigen
- RCAN3 (RCAN Family Member 3 (RCAN3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RCAN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RCAN3 antibody was raised against the middle region of RCAN3
- Aufreinigung
- Affinity purified
- Immunogen
- RCAN3 antibody was raised using the middle region of RCAN3 corresponding to a region with amino acids PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA
- Top Product
- Discover our top product RCAN3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RCAN3 Blocking Peptide, catalog no. 33R-7100, is also available for use as a blocking control in assays to test for specificity of this RCAN3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCAN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RCAN3 (RCAN Family Member 3 (RCAN3))
- Andere Bezeichnung
- RCAN3 (RCAN3 Produkte)
- Synonyme
- DSCR1L2 antikoerper, rcn3 antikoerper, hrcn3 antikoerper, mcip3 antikoerper, dscr1l2 antikoerper, MGC145788 antikoerper, MCIP3 antikoerper, RCN3 antikoerper, hRCN3 antikoerper, Dscr1l2 antikoerper, AU041093 antikoerper, Csp3 antikoerper, wu:fc68f05 antikoerper, zgc:113155 antikoerper, zgc:91820 antikoerper, RCAN family member 3 antikoerper, calcipressin-3 antikoerper, regulator of calcineurin 3 antikoerper, RCAN3 antikoerper, Tsp_08182 antikoerper, rcan3 antikoerper, Rcan3 antikoerper
- Hintergrund
- RCAN3 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. It could play a role during central nervous system development.
- Molekulargewicht
- 27 kDa (MW of target protein)
-