RCAN3 Antikörper (Middle Region)

Produktnummer ABIN634456

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch RCAN3 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für RCAN3 Antikörper (Middle Region) (ABIN634456)

Target: RCAN3 (RCAN Family Member 3 (RCAN3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RCAN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RCAN3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RCAN3 antibody was raised against the middle region of RCAN3

Aufreinigung: Affinity purified

Immunogen: RCAN3 antibody was raised using the middle region of RCAN3 corresponding to a region with amino acids PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RCAN3 Blocking Peptide, (ABIN5615813), is also available for use as a blocking control in assays to test for specificity of this RCAN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCAN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RCAN3

Target: RCAN3 (RCAN Family Member 3 (RCAN3))

Andere Bezeichnung: RCAN3

Hintergrund: RCAN3 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. It could play a role during central nervous system development.

Molekulargewicht: 27 kDa (MW of target protein)