LTA4H Antikörper (Middle Region)
-
- Target Alle LTA4H Antikörper anzeigen
- LTA4H (Leukotriene A4 Hydrolase (LTA4H))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LTA4H Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LTA4 H antibody was raised against the middle region of LTA4
- Aufreinigung
- Affinity purified
- Immunogen
- LTA4 H antibody was raised using the middle region of LTA4 corresponding to a region with amino acids NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG
- Top Product
- Discover our top product LTA4H Primärantikörper
-
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 135-272) antibody
LTA4H Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 163-191) antibodyLTA4H Reaktivität: Human WB, IF, IHC (p) Wirt: Kaninchen Polyclonal RB17402 unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reaktivität: Human WB, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reaktivität: Human, Ratte, Hund WB, IHC, IP Wirt: Maus Monoclonal 8F4 unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 107-311) antibodyLTA4H Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reaktivität: Human, Maus WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 467-516) antibodyLTA4H Reaktivität: Human, Maus, Ratte, Hund, Pferd, Kaninchen, Affe, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 101-150) antibodyLTA4H Reaktivität: Human, Maus, Ratte, Hund, Pferd, Rind (Kuh), Meerschweinchen, Affe, Fledermaus, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reaktivität: Human WB, IHC, IF, IP, FACS Wirt: Maus Monoclonal 9G8 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LTA4H Blocking Peptide, catalog no. 33R-6634, is also available for use as a blocking control in assays to test for specificity of this LTA4H antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTA0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LTA4H (Leukotriene A4 Hydrolase (LTA4H))
- Andere Bezeichnung
- LTA4H (LTA4H Produkte)
- Synonyme
- LTA4H antikoerper, zgc:85809 antikoerper, MGC78867 antikoerper, lta4h antikoerper, MGC69197 antikoerper, LOC732953 antikoerper, DDBDRAFT_0191291 antikoerper, DDBDRAFT_0216768 antikoerper, DDB_0191291 antikoerper, DDB_0216768 antikoerper, AmpT antikoerper, leukotriene A4 hydrolase antikoerper, leukotriene A4 hydrolase L homeolog antikoerper, Leukotriene A4 hydrolase antikoerper, LTA4H antikoerper, lta4h antikoerper, lta4h.L antikoerper, LOC732953 antikoerper, Shew185_1367 antikoerper, Sbal195_1406 antikoerper, XfasM23_0741 antikoerper, Sbal223_2977 antikoerper, lkhA antikoerper, Lta4h antikoerper
- Hintergrund
- LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.
- Molekulargewicht
- 69 kDa (MW of target protein)
-
