LTA4H Antikörper (Middle Region)

Produktnummer ABIN634453

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch LTA4H in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für LTA4H Antikörper (Middle Region) (ABIN634453)

Target: LTA4H (Leukotriene A4 Hydrolase (LTA4H))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LTA4H Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LTA4H Antikörper

Bindungsspezifität: Middle Region

Spezifität: LTA4 H antibody was raised against the middle region of LTA4

Aufreinigung: Affinity purified

Immunogen: LTA4 H antibody was raised using the middle region of LTA4 corresponding to a region with amino acids NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LTA4H Blocking Peptide, (ABIN5614603), is also available for use as a blocking control in assays to test for specificity of this LTA4H antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LTA4H

Target: LTA4H (Leukotriene A4 Hydrolase (LTA4H))

Andere Bezeichnung: LTA4H

Hintergrund: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Molekulargewicht: 69 kDa (MW of target protein)