ARF1 Antikörper (Middle Region)

Produktnummer ABIN634449

Produktdetails anti-ARF1 Antikörper

Target: ARF1 (ADP-Ribosylation Factor 1 (ARF1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARF1 antibody was raised against the middle region of ARF1

Aufreinigung: Affinity purified

Immunogen: ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARF1 Blocking Peptide, catalog no. 33R-6371, is also available for use as a blocking control in assays to test for specificity of this ARF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARF1

Target: ARF1 (ADP-Ribosylation Factor 1 (ARF1))

Andere Bezeichnung: ARF1 (ARF1 Produkte)

Synonyme: wu:fb33e02 antikoerper, wu:fb78h01 antikoerper, arf2 antikoerper, arf-1 antikoerper, MGC52573 antikoerper, ADP-RIBOSYLATION FACTOR antikoerper, ADP-RIBOSYLATION FACTOR 1A antikoerper, ADP-ribosylation factor 1 antikoerper, ATARF antikoerper, ATARF1 antikoerper, ATARFA1A antikoerper, F28C11.12 antikoerper, ARF1 antikoerper, arf1 antikoerper, ADP ribosylation factor 1 antikoerper, ADP-ribosylation factor 1 antikoerper, ADP ribosylation factor 1 L homeolog antikoerper, ADP ribosylation factor 5 L homeolog antikoerper, ADP ribosylation factor 1 pseudogene antikoerper, adp-ribosylation factor 1 antikoerper, ARF1 antikoerper, Arf1 antikoerper, arf1 antikoerper, arf1.L antikoerper, arf5.L antikoerper, NCU08340 antikoerper, TRIADDRAFT_63238 antikoerper, PAAG_08805 antikoerper, LOC100280562 antikoerper, LOC100280918 antikoerper, LOC474591 antikoerper, CLUG_01013 antikoerper

Hintergrund: ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Inositol Metabolic Process