RAB5 Antikörper (Middle Region)
-
- Target Alle RAB5 (RAB5A) Antikörper anzeigen
- RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAB5 A antibody was raised against the middle region of RAB5
- Aufreinigung
- Affinity purified
- Immunogen
- RAB5 A antibody was raised using the middle region of RAB5 corresponding to a region with amino acids SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS
- Top Product
- Discover our top product RAB5A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB5A Blocking Peptide, catalog no. 33R-8417, is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))
- Andere Bezeichnung
- RAB5A (RAB5A Produkte)
- Synonyme
- RAB5 antikoerper, 2410015H04Rik antikoerper, AI663973 antikoerper, AU021172 antikoerper, nnyRab5a antikoerper, DDBDRAFT_0168594 antikoerper, DDBDRAFT_0229401 antikoerper, DDB_0168594 antikoerper, DDB_0229401 antikoerper, rab5 antikoerper, RAB5A antikoerper, Rab5a antikoerper, rab5al antikoerper, zgc:56644 antikoerper, fj38g08 antikoerper, hm:zehn1144 antikoerper, rab5a antikoerper, wu:fj38g08 antikoerper, RAB5A, member RAS oncogene family antikoerper, rab5A protein antikoerper, Rab5a, GTPase antikoerper, predicted protein antikoerper, Rab GTPase antikoerper, RAB5A, member RAS oncogene family L homeolog antikoerper, RAB5A, member RAS oncogene family, b antikoerper, RAB5A, member RAS oncogene family, a antikoerper, RAB5A antikoerper, Rab5a antikoerper, rab5A antikoerper, rab5a antikoerper, rab5a.L antikoerper, rab5ab antikoerper, rab5aa antikoerper
- Hintergrund
- RAB5A is required for the fusion of plasma membranes and early endosomes.
- Molekulargewicht
- 24 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity
-