Pkc beta 1 Antikörper (N-Term)
-
- Target Alle Pkc beta 1 Antikörper anzeigen
- Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Ratte, Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Pkc beta 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKCB1 antibody was raised against the N terminal of PRKCB1
- Aufreinigung
- Affinity purified
- Immunogen
- PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
- Top Product
- Discover our top product Pkc beta 1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKCB1 Blocking Peptide, catalog no. 33R-1688, is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))
- Andere Bezeichnung
- PRKCB1 (Pkc beta 1 Produkte)
- Synonyme
- PKC-beta antikoerper, PKCB antikoerper, PRKCB1 antikoerper, PRKCB2 antikoerper, A130082F03Rik antikoerper, PKC-Beta antikoerper, Pkcb antikoerper, Prkcb1 antikoerper, Prkcb2 antikoerper, PKC antikoerper, PRKCB_tv2 antikoerper, protein kinase C beta antikoerper, protein kinase C, beta antikoerper, PRKCB antikoerper, Prkcb antikoerper
- Hintergrund
- Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.
- Molekulargewicht
- 77 kDa (MW of target protein)
-