SAMHD1 Antikörper (Middle Region)

Produktnummer ABIN634417

Produktdetails anti-SAMHD1 Antikörper

Target: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAMHD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SAMHD1 antibody was raised against the middle region of SAMHD1

Aufreinigung: Affinity purified

Immunogen: SAMHD1 antibody was raised using the middle region of SAMHD1 corresponding to a region with amino acids KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAMHD1 Blocking Peptide, catalog no. 33R-4405, is also available for use as a blocking control in assays to test for specificity of this SAMHD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMHD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAMHD1

Target: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Andere Bezeichnung: SAMHD1 (SAMHD1 Produkte)

Synonyme: CHBL2 antikoerper, DCIP antikoerper, HDDC1 antikoerper, MOP-5 antikoerper, SBBI88 antikoerper, si:dkeyp-44b8.8 antikoerper, E330031J07Rik antikoerper, Mg11 antikoerper, SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 antikoerper, SAM domain and HD domain 1 antikoerper, SAM domain and HD domain, 1 antikoerper, SAMHD1 antikoerper, samhd1 antikoerper, Samhd1 antikoerper

Hintergrund: SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha signaling.

Molekulargewicht: 72 kDa (MW of target protein)