SAMHD1 Antikörper (Middle Region)

Produktnummer ABIN634417

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SAMHD1 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für SAMHD1 Antikörper (Middle Region) (ABIN634417)

Target: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAMHD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SAMHD1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SAMHD1 antibody was raised against the middle region of SAMHD1

Aufreinigung: Affinity purified

Immunogen: SAMHD1 antibody was raised using the middle region of SAMHD1 corresponding to a region with amino acids KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAMHD1 Blocking Peptide, (ABIN939791), is also available for use as a blocking control in assays to test for specificity of this SAMHD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMHD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAMHD1

Target: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Andere Bezeichnung: SAMHD1

Hintergrund: SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha signaling.

Molekulargewicht: 72 kDa (MW of target protein)