GLMN Antikörper (Middle Region)
-
- Target Alle GLMN Antikörper anzeigen
- GLMN (Glomulin, FKBP Associated Protein (GLMN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GLMN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GLMN antibody was raised against the middle region of GLMN
- Aufreinigung
- Affinity purified
- Immunogen
- GLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYL
- Top Product
- Discover our top product GLMN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLMN Blocking Peptide, catalog no. 33R-5102, is also available for use as a blocking control in assays to test for specificity of this GLMN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLMN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLMN (Glomulin, FKBP Associated Protein (GLMN))
- Andere Bezeichnung
- GLMN (GLMN Produkte)
- Synonyme
- FAP antikoerper, FAP48 antikoerper, FAP68 antikoerper, FKBPAP antikoerper, GLML antikoerper, GVM antikoerper, VMGLOM antikoerper, 9330160J16Rik antikoerper, AW227515 antikoerper, Fap48 antikoerper, Fap68 antikoerper, MGC69174 antikoerper, GLMN antikoerper, zgc:194957 antikoerper, glmnl antikoerper, zgc:101567 antikoerper, glomulin, FKBP associated protein antikoerper, glomulin, FKBP associated protein L homeolog antikoerper, glomulin, FKBP associated protein b antikoerper, glomulin, FKBP associated protein a antikoerper, GLMN antikoerper, Glmn antikoerper, glmn.L antikoerper, glmn antikoerper, glmnb antikoerper, glmna antikoerper
- Hintergrund
- GLMN is a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Tube Formation
-