GNA15 Antikörper (N-Term)

Produktnummer ABIN634382

Produktdetails anti-GNA15 Antikörper

Target: GNA15 (Guanine Nucleotide Binding Protein (G Protein), alpha 15 (Gq Class) (GNA15))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNA15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GNA15 antibody was raised against the N terminal of GNA15

Aufreinigung: Affinity purified

Immunogen: GNA15 antibody was raised using the N terminal of GNA15 corresponding to a region with amino acids ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNA15 Blocking Peptide, catalog no. 33R-1493, is also available for use as a blocking control in assays to test for specificity of this GNA15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNA15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNA15

Target: GNA15 (Guanine Nucleotide Binding Protein (G Protein), alpha 15 (Gq Class) (GNA15))

Andere Bezeichnung: GNA15 (GNA15 Produkte)

Synonyme: GNA16 antikoerper, G[a]15 antikoerper, Galpha15 antikoerper, G protein subunit alpha 15 antikoerper, guanine nucleotide binding protein (G protein), alpha 15 (Gq class) antikoerper, guanine nucleotide binding protein, alpha 15 antikoerper, GNA15 antikoerper, Gna15 antikoerper

Hintergrund: GNA15 belongs to the G-alpha family. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Molekulargewicht: 41 kDa (MW of target protein)