CANT1 Antikörper (Middle Region)
-
- Target Alle CANT1 Antikörper anzeigen
- CANT1 (Calcium Activated Nucleotidase 1 (CANT1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CANT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CANT1 antibody was raised against the middle region of CANT1
- Aufreinigung
- Affinity purified
- Immunogen
- CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY
- Top Product
- Discover our top product CANT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CANT1 Blocking Peptide, catalog no. 33R-8666, is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CANT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CANT1 (Calcium Activated Nucleotidase 1 (CANT1))
- Andere Bezeichnung
- CANT1 (CANT1 Produkte)
- Synonyme
- DBQD antikoerper, SCAN-1 antikoerper, SCAN1 antikoerper, SHAPY antikoerper, 5830420C20Rik antikoerper, Apy1h antikoerper, D11Bwg0554e antikoerper, Entpd8 antikoerper, Shapy antikoerper, srapy antikoerper, apyrase antikoerper, xapy antikoerper, cant1 antikoerper, entpd8 antikoerper, zgc:85724 antikoerper, CANT1 antikoerper, zgc:101021 antikoerper, calcium activated nucleotidase 1 antikoerper, calcium activated nucleotidase 1 L homeolog antikoerper, calcium activated nucleotidase 1a antikoerper, calcium activated nucleotidase 1b antikoerper, CANT1 antikoerper, Cant1 antikoerper, cant1.L antikoerper, cant1 antikoerper, cant1a antikoerper, LOAG_01305 antikoerper, cant1b antikoerper
- Hintergrund
- CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP.
- Molekulargewicht
- 45 kDa (MW of target protein)
-