SH3BP2 Antikörper (Middle Region)

Produktnummer ABIN634378

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SH3BP2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für SH3BP2 Antikörper (Middle Region) (ABIN634378)

Target: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3BP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SH3BP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SH3 BP2 antibody was raised against the middle region of SH3 P2

Aufreinigung: Affinity purified

Immunogen: SH3 BP2 antibody was raised using the middle region of SH3 P2 corresponding to a region with amino acids RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3BP2 Blocking Peptide, (ABIN5616123), is also available for use as a blocking control in assays to test for specificity of this SH3BP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3BP2

Target: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Andere Bezeichnung: SH3BP2

Hintergrund: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg