SH3BP2 Antikörper (Middle Region)
-
- Target Alle SH3BP2 Antikörper anzeigen
- SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SH3BP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SH3 BP2 antibody was raised against the middle region of SH3 P2
- Aufreinigung
- Affinity purified
- Immunogen
- SH3 BP2 antibody was raised using the middle region of SH3 P2 corresponding to a region with amino acids RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ
- Top Product
- Discover our top product SH3BP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SH3BP2 Blocking Peptide, catalog no. 33R-8125, is also available for use as a blocking control in assays to test for specificity of this SH3BP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))
- Andere Bezeichnung
- SH3BP2 (SH3BP2 Produkte)
- Synonyme
- SH3BP2 antikoerper, 3BP-2 antikoerper, 3BP2 antikoerper, CRBM antikoerper, CRPM antikoerper, SH3 domain binding protein 2 antikoerper, SH3-domain binding protein 2 antikoerper, SH3BP2 antikoerper, Sh3bp2 antikoerper
- Hintergrund
- SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- T-Zell Rezeptor Signalweg
-