SH3BP2 Antikörper (Middle Region)

Produktnummer ABIN634378

Produktdetails anti-SH3BP2 Antikörper

Target: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3BP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SH3 BP2 antibody was raised against the middle region of SH3 P2

Aufreinigung: Affinity purified

Immunogen: SH3 BP2 antibody was raised using the middle region of SH3 P2 corresponding to a region with amino acids RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3BP2 Blocking Peptide, catalog no. 33R-8125, is also available for use as a blocking control in assays to test for specificity of this SH3BP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3BP2

Target: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Andere Bezeichnung: SH3BP2 (SH3BP2 Produkte)

Synonyme: SH3BP2 antikoerper, 3BP-2 antikoerper, 3BP2 antikoerper, CRBM antikoerper, CRPM antikoerper, SH3 domain binding protein 2 antikoerper, SH3-domain binding protein 2 antikoerper, SH3BP2 antikoerper, Sh3bp2 antikoerper

Hintergrund: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg