Uromodulin Antikörper (Middle Region)

Produktnummer ABIN634373

Produktdetails anti-Uromodulin Antikörper

Target: Uromodulin (UMOD)

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Uromodulin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Uromodulin antibody was raised against the middle region of UMOD

Aufreinigung: Affinity purified

Immunogen: Uromodulin antibody was raised using the middle region of UMOD corresponding to a region with amino acids MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Uromodulin Blocking Peptide, catalog no. 33R-6556, is also available for use as a blocking control in assays to test for specificity of this Uromodulin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMOD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Uromodulin

Target: Uromodulin (UMOD)

Andere Bezeichnung: Uromodulin (UMOD Produkte)

Synonyme: ADMCKD2 antikoerper, FJHN antikoerper, HNFJ antikoerper, HNFJ1 antikoerper, MCKD2 antikoerper, THGP antikoerper, THP antikoerper, urehr4 antikoerper, uromodulin antikoerper, UMOD antikoerper, Umod antikoerper

Hintergrund: This gene encodes uromodulin, the most abundant protein in normal urine.

Molekulargewicht: 67 kDa (MW of target protein)