Sorting Nexin 7 Antikörper (Middle Region)
-
- Target Alle Sorting Nexin 7 (SNX7) Antikörper anzeigen
- Sorting Nexin 7 (SNX7)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Sorting Nexin 7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SNX7 antibody was raised against the middle region of SNX7
- Aufreinigung
- Affinity purified
- Immunogen
- SNX7 antibody was raised using the middle region of SNX7 corresponding to a region with amino acids LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND
- Top Product
- Discover our top product SNX7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SNX7 Blocking Peptide, catalog no. 33R-4867, is also available for use as a blocking control in assays to test for specificity of this SNX7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Sorting Nexin 7 (SNX7)
- Andere Bezeichnung
- SNX7 (SNX7 Produkte)
- Synonyme
- zgc:92458 antikoerper, SNX7 antikoerper, 2510028H01Rik antikoerper, sorting nexin 7 antikoerper, sorting nexin-7 antikoerper, SNX7 antikoerper, snx7 antikoerper, LOC715581 antikoerper, LOC716015 antikoerper, Snx7 antikoerper
- Hintergrund
- This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.
- Molekulargewicht
- 45 kDa (MW of target protein)
-