ARL8A Antikörper (Middle Region)
-
- Target Alle ARL8A Antikörper anzeigen
- ARL8A (ADP-Ribosylation Factor-Like 8A (ARL8A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARL8A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARL8 A antibody was raised against the middle region of ARL8
- Aufreinigung
- Affinity purified
- Immunogen
- ARL8 A antibody was raised using the middle region of ARL8 corresponding to a region with amino acids IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ
- Top Product
- Discover our top product ARL8A Primärantikörper
-
anti-ADP-Ribosylation Factor-Like 8A (ARL8A) (AA 116-142) antibody
ARL8A Reaktivität: Human, Maus WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB22845 unconjugated
anti-ADP-Ribosylation Factor-Like 8A (ARL8A) (AA 123-150), (Middle Region) antibodyARL8A Reaktivität: Human, Maus WB, FACS, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-ADP-Ribosylation Factor-Like 8A (ARL8A) antibodyARL8A Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-ADP-Ribosylation Factor-Like 8A (ARL8A) (AA 82-110) antibodyARL8A Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB32929 unconjugated
anti-ADP-Ribosylation Factor-Like 8A (ARL8A) (AA 72-121) antibodyARL8A Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Kaninchen, Schaf, Huhn, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-ADP-Ribosylation Factor-Like 8A (ARL8A) (AA 1-186) antibodyARL8A Reaktivität: Human ELISA, WB, IF Wirt: Maus Monoclonal 3H4 unconjugated
anti-ADP-Ribosylation Factor-Like 8A (ARL8A) (AA 107-156) antibodyARL8A Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Kaninchen, Schaf, Hund, Huhn, Meerschweinchen, Zebrafisch (Danio rerio), Affe, Fledermaus, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-ADP-Ribosylation Factor-Like 8A (ARL8A) (AA 71-120) antibodyARL8A Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Kaninchen, Schaf, Hund, Huhn, Affe, Fledermaus, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-ADP-Ribosylation Factor-Like 8A (ARL8A) (AA 1-186) antibodyARL8A Reaktivität: Human, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARL8A Blocking Peptide, catalog no. 33R-3970, is also available for use as a blocking control in assays to test for specificity of this ARL8A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARL8A (ADP-Ribosylation Factor-Like 8A (ARL8A))
- Andere Bezeichnung
- ARL8A (ARL8A Produkte)
- Synonyme
- gie2 antikoerper, MGC75773 antikoerper, fe25e11 antikoerper, si:ch1073-204j4.2 antikoerper, wu:fe25e11 antikoerper, PTPN7 antikoerper, ARL10B antikoerper, GIE2 antikoerper, 1110033P22Rik antikoerper, Arl10b antikoerper, RGD1565940 antikoerper, ADP ribosylation factor like GTPase 8A antikoerper, ARF-like GTPase antikoerper, ADP-ribosylation factor-like 8A antikoerper, ADP-ribosylation factor like GTPase 8A antikoerper, arl8a antikoerper, ARL8A antikoerper, ARL8a-2 antikoerper, ARL8a-1 antikoerper, Arl8a antikoerper
- Hintergrund
- ARL8A belongs to the small GTPase superfamily, Arf family. ARL8A m,ay play a role in lysosomes motility. Alternatively, may play a role in chromosomes segregation.
- Molekulargewicht
- 21 kDa (MW of target protein)
-
