DDAH1 Antikörper (Middle Region)
-
- Target Alle DDAH1 Antikörper anzeigen
- DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDAH1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DDAH1 antibody was raised against the middle region of DDAH1
- Aufreinigung
- Affinity purified
- Immunogen
- DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT
- Top Product
- Discover our top product DDAH1 Primärantikörper
-
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 20-215) antibody
DDAH1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (C-Term) antibodyVerified DDAH1 Reaktivität: Human WB, ELISA, IF, FACS Wirt: Ziege Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 221-250), (C-Term) antibodyDDAH1 Reaktivität: Human, Maus WB, IF, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB20529 unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) antibodyDDAH1 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 181-285) antibodyDDAH1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3F7 unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (C-Term) antibodyDDAH1 Reaktivität: Human WB, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 1-285) antibodyDDAH1 Reaktivität: Human WB, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) antibodyDDAH1 Reaktivität: Human WB Wirt: Kaninchen Monoclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 108-157) antibodyDDAH1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Hund, Zebrafisch (Danio rerio), Affe, Fledermaus, Huhn, Schwein, Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 108-157) antibodyDDAH1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Affe, Fledermaus, Huhn, Schwein, Xenopus laevis, Drosophila melanogaster WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDAH1 Blocking Peptide, catalog no. 33R-1329, is also available for use as a blocking control in assays to test for specificity of this DDAH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))
- Andere Bezeichnung
- DDAH1 (DDAH1 Produkte)
- Synonyme
- DDAH antikoerper, 2410006N07Rik antikoerper, 2510015N06Rik antikoerper, AI987801 antikoerper, AW050362 antikoerper, DDAH1 antikoerper, wu:fc30c11 antikoerper, zgc:85829 antikoerper, dimethylarginine dimethylaminohydrolase 1 antikoerper, dimethylarginine dimethylaminohydrolase 1 L homeolog antikoerper, DDAH1 antikoerper, Ddah1 antikoerper, ddah1.L antikoerper, ddah1 antikoerper
- Hintergrund
- DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
- Molekulargewicht
- 31 kDa (MW of target protein)
-
