DDAH1 Antikörper (Middle Region)

Produktnummer ABIN634363

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch DDAH1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für DDAH1 Antikörper (Middle Region) (ABIN634363)

Target: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDAH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDAH1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: DDAH1 antibody was raised against the middle region of DDAH1

Aufreinigung: Affinity purified

Immunogen: DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDAH1 Blocking Peptide, (ABIN936715), is also available for use as a blocking control in assays to test for specificity of this DDAH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDAH1

Target: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Andere Bezeichnung: DDAH1

Hintergrund: DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.

Molekulargewicht: 31 kDa (MW of target protein)