SHB Antikörper (N-Term)
-
- Target Alle SHB Antikörper anzeigen
- SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SHB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SHB antibody was raised against the N terminal of SHB
- Aufreinigung
- Affinity purified
- Immunogen
- SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA
- Top Product
- Discover our top product SHB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SHB Blocking Peptide, catalog no. 33R-5681, is also available for use as a blocking control in assays to test for specificity of this SHB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))
- Andere Bezeichnung
- SHB (SHB Produkte)
- Synonyme
- SHB antikoerper, RP11-3J10.8 antikoerper, bA3J10.2 antikoerper, RGD1565350 antikoerper, BC028832 antikoerper, SH2 domain containing adaptor protein B antikoerper, src homology 2 domain-containing transforming protein B antikoerper, SHB antikoerper, Shb antikoerper
- Hintergrund
- SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling.
- Molekulargewicht
- 55 kDa (MW of target protein)
-